PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BL_A85CEE3C1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 377aa    MW: 41097.9 Da    PI: 7.2774
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BL_A85CEE3C1.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.4e-11177235563
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l+ l+   + l+se+
  Traes_5BL_A85CEE3C1.1 177 KRAKRIWANRQSAARSKERKMRYIGELERKVQTLQTEATTLSAQLSLLQRDTSGLTSEN 235
                            9************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-17173237IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909175238IPR004827Basic-leucine zipper domain
PfamPF001706.3E-10177235IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-10177233No hitNo description
SuperFamilySSF579593.52E-11177228No hitNo description
CDDcd147031.10E-22178227No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MNKDRSRISA DGGGGDGLPP QPSRRSSTPP PEYDISRMPD FPTRNPGHRR AHSEILSLPD  60
DLDLCAPGGG DGPSLSDEND EELFSMFLDV DKLNSSCGPS SDQAESSSAA AAGGGEAARA  120
GHVMRPKHQH SQSMDESMSI KAEDLVGAPG MEGMSTVEAK KAVSAAKLAE LALVDPKRAK  180
RIWANRQSAA RSKERKMRYI GELERKVQTL QTEATTLSAQ LSLLQRDTSG LTSENSELKI  240
RLQNMEQQVH LQDALNDTLK TEVQRLKVAT GQMGNGGGML MNYGGMSQAP HQFGSNQQMF  300
HNSQSMQSLL ATHQLQQLQL HQQPQQQQQP MRPQHHHHQQ QQPLHPLQAQ LFQQAARDLK  360
MKGPMWGDGK SSGGGGI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3564330.0AK356433.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1034M13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576732.10.0PREDICTED: transcription factor RF2a-like
RefseqXP_014758763.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ69IL41e-155RF2A_ORYSJ; Transcription factor RF2a
TrEMBLW5FG600.0W5FG60_WHEAT; Uncharacterized protein
STRINGMLOC_64781.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-99bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]